PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g10380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 294aa    MW: 32027.2 Da    PI: 9.1547
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g10380.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-1482126347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I++   k+Rt+ q+ s+ qky
   Vang11g10380.1  82 PWTEEEHKLFLVGLQKVGKGDWRGISKNYVKTRTPTQVASHAQKY 126
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.26275131IPR017930Myb domain
SuperFamilySSF466893.07E-1777132IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-1778129IPR006447Myb domain, plants
SMARTSM007173.9E-1079129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-1181126IPR009057Homeodomain-like
PfamPF002495.9E-1282126IPR001005SANT/Myb domain
CDDcd001677.98E-1082127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSRACAATDS VASGEIMLFG VRVVVDSMRK SVSMNNLSQY EHRHDANNNN KDVLAVGYAS  60
ADDAVPHNTG RHRERERKRG VPWTEEEHKL FLVGLQKVGK GDWRGISKNY VKTRTPTQVA  120
SHAQKYFLRR SNLNRRRRRS SLFDITTDMV SAIPMEEEQV QNHDTLFHPQ AVCPAVPETS  180
KSGIPMMPVY QFGIGSGAIA VQGGKPLEEL TLGQGNIEPN VPINLVRVIP VVADPKASTV  240
SDIITPSSSS ALDPPTLSLG LAFSSDQRQT SSRHSALHAM PCFSNGDSII SVA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510415.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B03e-71MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0S3R7S90.0A0A0S3R7S9_PHAAN; Uncharacterized protein
STRINGGLYMA05G01640.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.26e-57MYB_related family protein